Product Description:

NT-4 is a neurotrophic factor structurally related to β-NGF, BDNF, and NT-3. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. NT-4 is expressed in the prostate, thymus, placenta, and skeletal muscle. NT-4 can signal through the LNGFR and trkB receptors, and promotes the survival of peripheral sensory sympathetic neurons. Recombinant Human NT-4 is a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (260 total amino acid residues).

Technical Specifications:

  • Species: Human
  • Expression: E. Coli Cell Expressed
  • Activity: Typically 20-50 ng/ml ED50
  • Purity: ≥98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 14 kDa
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures was found in the range of 20-50 ng/ml.

AA Sequence:

GVSETAPASRRGELAVCDAVSGWVTDRRTA
VDLRGREVEVLGEVPAAGGSPLRQYFFETR
CKADNAEEGGPGAGGGGCRGVDRRHWVSEC
KAKQSYVRALTADAQGRVGWRWIRIDTACV
CTLLSRTGRA

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.