Product Description:

IL-8 is a proinflammatory CXC chemokine that can signal through the CXCR1 and CXCR2 receptors. It is secreted by monocytes and endothelial cells. IL-8 chemoattracts and activates neutrophils. Recombinant Human IL-8 (monocyte-derived) is an 8.4 kDa protein containing 72 amino acid residues.

Technical Specifications:

  • Species: Human
  • Expression: E. coli Cell Expressed
  • Purity: >98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 8.4 kDa
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 10.0-100.0 ng/ml.

AA Sequence:

SAKELRCQCIKTYSKPFHPKFIKELRVIES
GPHCANTEIIVKLSDGRELCLDPKENWVQR
VVEKFLKRAENS

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at -20°C to -80°C.