Product Description:

RANTES is a CC chemokine that can signal through the CCR1, CCR3, CCR5 and US28 (cytomegalovirus receptor) receptors. It is a chemoattractant towards monocytes, memory T cells (CD4+/CD45RO), basophils, and eosinophils. RANTES also has the capability to inhibit certain strains of HIV-1, HIV-2 and simian immunodeficiency virus (SIV). Recombinant Human RANTES is a 7.8 kDa protein containing 68 amino acid residues, including the four highly conserved cysteine residues present in the CC chemokines.

Technical Specifications:

  • Species: Human
  • Expression: E. coli Cell Expressed
  • Purity: ≥98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 7.8 kDa
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

Determined by its ability to chemoattract human blood monocytes using a concentration range of 1.0-10.0 ng/ml.

AA Sequence:

SPYSSDTTPCCFAYIARPLPRAHIKEYFYT
SGKCSNPAVVFVTRKNRQVCANPEKKWVRE
YINSLEMS

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.