Product Description:

BDNF is a member of the NGF family of neurotrophic growth factors. Like other members of this family, BDNF supports neuron proliferation and survival. BDNF can bind to a low affinity cell surface receptor called LNGFR, which also binds other neurotrophins such as NGF, NT-3 and NT-4. However, BDNF mediates its neurotrophic properties by signaling through a high affinity cell surface receptor called gp145/trkB. BDNF is expressed as the C-terminal portion of a 247 amino acid polypeptide precursor, which also contains a signal sequence of 18 amino acid residues and a propeptide of 110 amino acid residues. Recombinant Human BDNF is a 27.0 kDa homodimer of two 120 amino acid subunits linked by strong non-covalent interactions. Human and Mouse BDNF sequences are identical.

Technical Specifications:

  • Species: Human
  • Expression: E. coli Cell Expressed
  • Activity: Typically 0.5-1.0 μg/mL ED50
  • Purity: >98%
  • Endotoxin: <1.0 EU/μg
  • Molecular Mass: 27.0 kDa, homodimer
  • Country of Origin: USA

Purity Confirmation:

This was determined by SDS-PAGE gel and HPLC analysis.

Activity Assay:

Determined by its ability to stimulate the proliferation of rat C6 cells.

AA Sequence:

MHSDPARRGELSVCDSISEWVTAADKKTAV
DMSGGTVTVLEKVPVSKGQLKQYFYETKCN
PMGYTKEGCRGIDKRHWNSQCRTTQSYVRA
LTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Reconstitution Buffer:

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex.

Storage:

For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% HSA) and store in working aliquots at-20°C to -80°C.